PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G141300.1.p
Common NameSb02g013010, SORBIDRAFT_02g013010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 367aa    MW: 38984.9 Da    PI: 9.5495
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G141300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.5e-192166147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                          +g+W++eEde l ++v+++G ++W++I+r ++ gR++k+c++rw + 
  Sobic.002G141300.1.p 21 KGPWSPEEDEALQRLVARHGARNWSLISRSIP-GRSGKSCRLRWCNQ 66
                          79******************************.***********985 PP

2Myb_DNA-binding53.55.7e-1775117347
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           ++T+eEd+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
  Sobic.002G141300.1.p  75 PFTPEEDDTILRAHARFGNK-WATIARLLS-GRTDNAIKNHWNST 117
                           89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.5971671IPR017930Myb domain
SuperFamilySSF466894.12E-3218114IPR009057Homeodomain-like
SMARTSM007178.3E-172069IPR001005SANT/Myb domain
PfamPF002492.4E-182166IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-262274IPR009057Homeodomain-like
CDDcd001676.21E-162365No hitNo description
SMARTSM007171.7E-1472120IPR001005SANT/Myb domain
PROSITE profilePS5129420.33873122IPR017930Myb domain
PfamPF002491.9E-1475117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2375121IPR009057Homeodomain-like
CDDcd001671.46E-1175118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MASSSPSCRG GGNKADVDRI KGPWSPEEDE ALQRLVARHG ARNWSLISRS IPGRSGKSCR  60
LRWCNQLSPQ VEHRPFTPEE DDTILRAHAR FGNKWATIAR LLSGRTDNAI KNHWNSTLKR  120
KYYAASAADG DAANGGAADA DDERPLKRTS SDGHPGLCFS PGSPSGSDLS DSSHHSLPSV  180
MPSAASAAAA AVTSQQQQQQ HVYRPVPRAG GVVVLPVAPP LAPRPPSPPP PPPPQQQPPP  240
ATSLSLSLSL PGLDQQPEPS PATAPPQPPV QIHQHQAAPP QMPPPPPQAQ PSPRLPFQLQ  300
PAPATNLTSP QPAAAAPFSS EFLLMMQEMI RIEVRNYMSG SGFDPRADGA SVHAVTKRMM  360
GMAKIE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-39181214107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.16080.0callus| embryo| leaf| shoot
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794250.0HF679425.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB19 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462029.10.0hypothetical protein SORBIDRAFT_02g013010
TrEMBLC5X6Q80.0C5X6Q8_SORBI; Putative uncharacterized protein Sb02g013010
STRINGSb02g013010.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.19e-64myb domain protein 73